Antibodies
| Rabbit polyclonal antibody to MMP9 | |
|---|---|
 Immunohistochemical detection of MMP9 in formalin fixed human prostate cancer. 15 μm paraffin-embedded tissue sections were incubated with rabbit polyclonal antibody to MMP9 at 10 μg/mL overnight at 4°C followed by HRP/AEC detection (red) and counterstaining with hematoxylin (blue). |
 |
| Formulation | Lyophilized powder |
| Purification | Affinity purified |
| Host Species | Rabbit |
| Unit Size: | 100 µg |
| Immunogen | Synthetic peptide |
| Sequence: | VAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTR |
| Alternative Names | 92 kDa gelatinase, 92 kDa type IV collagenase, Gelatinase B |
| Accession Number: | P14780 |
| Gene Symbol | MMP9 |
| Accession URL: | http://www.uniprot.org/uniprot/P14780 |
| Function: MMP9 degrades type IV and V collagens and is involved inproteolysis of the extracellular matrix. Produced by granulocytes and macrophages. MMP9 is involved with tissue destruction in a cancer invasion and metastasis, rheumatoid arthiritis, fibrotic lung disease and cardiomyopathy. |
|
| Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
| Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
| Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
| Working Dilution for Western Blottin (WB): | 1 µg/mL |
| IHC Positive control: | embryos, tumors of different origin |
| Specificity: | Confirmed by WB. |
| Reactivity: | Human, Mouse, Rat |
| Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
| Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
|
|